PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g010690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family M-type_MADS
Protein Properties Length: 337aa    MW: 38431.1 Da    PI: 4.8759
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g010690.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.97.3e-151156348
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                      i+++ +r  tf kR++ + KK +ELS+LCd+++++ii+  + +   
  Sopen11g010690.1 11 IQDHKKRMNTFVKRKASLVKKISELSILCDIKACMIIYEGNSNCEM 56
                      89999********************************976665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.423148IPR002100Transcription factor, MADS-box
SMARTSM004325.1E-14159IPR002100Transcription factor, MADS-box
CDDcd002661.71E-19268No hitNo description
SuperFamilySSF554559.94E-20290IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-9323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRSKIKVEL IQDHKKRMNT FVKRKASLVK KISELSILCD IKACMIIYEG NSNCEMWPND  60
PNEVKELINL YKDQPFEGRT KRGKTLSNYF KDEIKVEKDP DSRFDYFEND EKKKDDAINV  120
EKYPTWDSRF DYLSQKEIQN LVGVISKRTE NAKGRIELLK SMNGSCSLSH QQQIWDYNNL  180
MNQTSLWPIS DHVNSFNNIF QSNIGVNSMM ESENWLANDE IGSSLAMHPL GNNYGIIDSS  240
STMMLPMGNN EIGSSSTMQQ PMYQYPFMYN GSTHVIGSSS TMQPPMGQYP FTNNDDSTGD  300
IGSSSMQPMG NNNEIGSALT VQPMDNDSTY DSCTFYY
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250617.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLK4D7180.0K4D718_SOLLC; Uncharacterized protein
STRINGSolyc11g020660.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-19M-type_MADS family protein